Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22R alpha 1, Mouse (HEK293, Fc)

IL-22R α 1 and IL-10R β together form IL20, IL22 and IL24 receptor complexes, activating different signaling pathways. Within the IL22 receptor, IL-22R α 1 binds to IL10RB and mediates IL22 signaling through the JAK/STAT and MAPK1/MAPK3/Akt pathways. IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-22R alpha 1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IL-22R alpha 1 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22r-alpha-1-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

HTTVDTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKYGERKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTTIKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWA

Molecular Formula

230828 (Gene_ID) Q80XZ4 (H16-A228) (Accession)

Molecular Weight

65-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transketolase (TKT) activation kit by CRISPRa
GA104887 1 Kit

Human Transketolase (TKT) activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE,  10nm
GAF-005-10 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE, 10nm

Sign In for Pricing
View Details
1-Phenyl-3-oxabicyclo[3.1.0]hexan-2-one
TRC-P336115-50G 50 g

1-Phenyl-3-oxabicyclo[3.1.0]hexan-2-one

Sign In for Pricing
View Details
Rdh10 (NM_133832) Mouse Recombinant Protein
TP505116 20 µg

Rdh10 (NM_133832) Mouse Recombinant Protein

Sign In for Pricing
View Details
CCR3 Human Recombinant Protein, Membrane Nanoparticle
TP721869 50 µg

CCR3 Human Recombinant Protein, Membrane Nanoparticle

Sign In for Pricing
View Details
Amplite® Fluorimetric Protein Quantitation Kit *Orange Fluorescence*
11105-AAT 500 Tests

Amplite® Fluorimetric Protein Quantitation Kit *Orange Fluorescence*

Sign In for Pricing
View Details