Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-beta, Rhesus Macaque (HEK293, Fc)

IFN-beta Protein is an immunomodulatory cytokine of the type 1 interferon family. IFN-beta Protein reduces joint inflammation by inhibiting the RANKL-c-Fos signaling pathway. IFN-beta Protein regulates mitochondrial fission through STAT5, PGAM5, and Drp1 to rescue neurodegeneration. IFN-beta Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived IFN-beta protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

IFN-beta Protein, Rhesus Macaque (HEK293, Fc), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-beta-protein-rhesus-hek293-fc.html

Purity

95.00

Smiles

MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN

Molecular Formula

/ (Gene_ID) EHH24077.1 (M22-N187) (Accession)

Molecular Weight

Approximately 45-56 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details