Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 3 (CCL3)

Product Specifications

Product Name Alternative

(G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) (4-69) (LD78-alpha (4-69)

Abbreviation

Recombinant Human CCL3 protein

Gene Name

CCL3

UniProt

P10147

Expression Region

24-92aa

Organism

Homo sapiens (Human)

Target Sequence

SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.6 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus Siglec-3 / CD33 Protein, His Tag (MALS verified)
CD3-C52H4-1mg 1 mg

Cynomolgus Siglec-3 / CD33 Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Easypro Mouse Lysyl Trna Synthetase (KARSL) ELISA Kit
FY-EM3533S 96 Well

Easypro Mouse Lysyl Trna Synthetase (KARSL) ELISA Kit

Sign In for Pricing
View Details
AdmiRa-hsa-miR-3135a-Off Virus
mh5455 1.0 mL

AdmiRa-hsa-miR-3135a-Off Virus

Sign In for Pricing
View Details
Rulonilimab Biosimilar - Research Grade
ICH5840-1mg 1 mg

Rulonilimab Biosimilar - Research Grade

Sign In for Pricing
View Details
CKMT1A Antibody
MBS7127557-01 0.05 mL

CKMT1A Antibody

Sign In for Pricing
View Details
CKMT1A Antibody
MBS7127557-02 0.1 mL

CKMT1A Antibody

Sign In for Pricing
View Details