Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15) (Active)

Product Specifications

Product Name Alternative

Interleukin-15; IL-15; IL15

Abbreviation

Recombinant Human IL15 protein (Active)

Gene Name

IL15

UniProt

P40933

Expression Region

49-162aa

Organism

Homo sapiens (Human)

Target Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Human Interleukin 15 (IL-15) is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL15 receptor (IL-15RA) with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other's activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs. Mature Human IL-15 shares 70% amino acid sequence identity with Mouse and Rat IL-15.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is 40-200pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mebroqualone
TRC-M202545-250MG 250 mg

Mebroqualone

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 7 (GRM7) Human Gene Knockout Kit (CRISPR)
KN417402 1 Kit

Metabotropic Glutamate Receptor 7 (GRM7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]
E-AB-F1177C-01 50 Tests

FITC Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]

Sign In for Pricing
View Details
FITC Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]
E-AB-F1177C-02 100 Tests

FITC Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]

Sign In for Pricing
View Details
FITC Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]
E-AB-F1177C-03 2x 100 Tests

FITC Anti-Mouse CD150/SLAM Antibody[TC15-12F12.2]

Sign In for Pricing
View Details
OR7C1 Human Gene Knockout Kit (CRISPR)
KN416280 1 Kit

OR7C1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details