Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Canine (P.pastoris)

The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (P.pastoris) is the recombinant canine-derived EGF protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

EGF Protein, Canine (P.pastoris), Canine, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-canine-p-pastoris.html

Purity

95.30

Smiles

NGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR

Molecular Formula

403657 (Gene_ID) Q9BEA0 (N973-R1024) (Accession)

Molecular Weight

Approximately 6.2 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Butoxyphenol
TRC-B690590-25G 25 g

4-Butoxyphenol

Sign In for Pricing
View Details
Cytochrome P450 1A2 (CYP1A2) (NM_000761) Human Over-expression Lysate
LC424529 20 µg

Cytochrome P450 1A2 (CYP1A2) (NM_000761) Human Over-expression Lysate

Sign In for Pricing
View Details
SNAPC3 (NM_001039697) Human Over-expression Lysate
LC421891 20 µg

SNAPC3 (NM_001039697) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-1,1′-Binaphthyl-2,2′-disulfonimide
TRC-R288115-100MG 100 mg

(R)-1,1′-Binaphthyl-2,2′-disulfonimide

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF740 conjugate, 0.1mg/mL
BNC742808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Gaa activation kit by CRISPRa
GA201509 1 Kit

Mouse Gaa activation kit by CRISPRa

Sign In for Pricing
View Details