Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phlebia radiata Ligninase-3

Product Specifications

Product Name Alternative

Diarylpropane peroxidase; Lignin peroxidase; Ligninase III

Abbreviation

Recombinant Phlebia radiata Ligninase-3 protein

UniProt

P20010

Expression Region

21-361aa

Organism

Phlebia radiata (White-rot fungus)

Target Sequence

VTRRATCPDGTQLMNAECCALLAVRDDLQNNMFNNECGDEAHEALRLTFHDAIAISPAMEATGQFGGGGADGSIMIFSDIETKFHPNIGLDEVVESFRPFQQRSGMGVADFIQFSGAVGTSNCPGAPTLNAFIGRKDATQAAPDGLVPEPFHDVNTILARFNDAGDFDELETVWFLIAHSVAAQNDIDPAVSHAPFDSTPSVMDGQFFIETQLRGVEFIGSGGIEGVAESPVKGEFRLMSDQQIARDNRTACEWQSFGTDQAKLQNRFQFIFEAMGQLGTDPTTLIDCSDVLPVPPPLSTVPHFPAGITINDVEPACAETPFPTLPTDPGPATAVAAVPRD

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Depolymerization of lignin. Catalyzes the C (alpha) -C (beta) cleavage of the propyl side chains of lignin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL
BNC880788-500 1x 500 µL

MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF568 conjugate, 0.1mg/mL
BNC681917-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2908R), CF405S conjugate, 0.1mg/mL
BNC042908-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2908R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details