Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-18 (IL18)

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor ; IFN-gamma-inducing factorInterleukin-1 gamma ; IL-1 gamma

Abbreviation

Recombinant Dog IL18 protein

Gene Name

IL18

UniProt

Q9XSR0

Expression Region

37-193aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2,3,5-Tri-O-benzoyl-Beta-D-ribofuranosyl)-4-thiazolecarboxylic Acid Ethyl Ester
TRC-T767710-250MG 250 mg

2-(2,3,5-Tri-O-benzoyl-Beta-D-ribofuranosyl)-4-thiazolecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
ENT2 Recombinant Rabbit Monoclonal Antibody [JE33-88]
HA722746 100 µL

ENT2 Recombinant Rabbit Monoclonal Antibody [JE33-88]

Sign In for Pricing
View Details
Recombinant PDGFR alpha Antibody
RC-4880-01 50 μL

Recombinant PDGFR alpha Antibody

Sign In for Pricing
View Details
Recombinant PDGFR alpha Antibody
RC-4880-02 100 µL

Recombinant PDGFR alpha Antibody

Sign In for Pricing
View Details
Recombinant PDGFR alpha Antibody
RC-4880-03 1 mL

Recombinant PDGFR alpha Antibody

Sign In for Pricing
View Details
Pigp Mouse Gene Knockout Kit (CRISPR)
KN513275 1 Kit

Pigp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details