Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICA, Mouse (HEK293, His)

ICA Protein, a potent inhibitor of carbonic anhydrase 2 (CA2), intricately regulates enzymatic activity within a finely tuned network. Functionally, ICA, a non-iron-binding monomer, exhibits specificity in inhibiting CA2. Its transferrin-like domain 2 engages in molecular interactions, underscoring ICA's regulatory role. This positions ICA as a key player, adding nuance to the precise mechanisms governing carbonic anhydrase activity. ICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICA protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ICA Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ica-protein-mouse-hek293-his.html

Purity

98.00

Smiles

LPEKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRGLEDSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGWNVPMGLIYNQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSNLQNKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY

Molecular Formula

71775 (Gene_ID) Q9DBD0/NP_082194.1 (L20-Y700) (Accession)

Molecular Weight

Approximately 76.2-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details