Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Human (HEK293, hFc)

IL-18BP Protein belongs to immunoglobulin superfamily that bind to IL-18 and inhibits its activity. IL-18BP Protein functions as an inhibitor of the Th1 cytokine response[1]. IL-18BP Protein, Human (HEK293, hFc) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-human-164a-a-hek293-fc.html

Purity

97.00

Smiles

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Molecular Formula

10068 (Gene_ID) AAD17187.1 (T29-G192) (Accession)

Molecular Weight

Approximately 60-75 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
BNC940806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF488A conjugate, 0.1mg/mL
BNC880693-100 1x 100 µL

CD56 / NCAM (123C3.D5 + 123A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF488A conjugate, 0.1mg/mL
BNC881555-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106 + TMS715), CF640R conjugate, 0.1mg/mL
BNC400716-500 1x 500 µL

Thymidylate Synthase (TS106 + TMS715), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details