Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Human (HEK293, hFc)

IL-18BP Protein belongs to immunoglobulin superfamily that bind to IL-18 and inhibits its activity. IL-18BP Protein functions as an inhibitor of the Th1 cytokine response[1]. IL-18BP Protein, Human (HEK293, hFc) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-human-164a-a-hek293-fc.html

Purity

97.00

Smiles

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Molecular Formula

10068 (Gene_ID) AAD17187.1 (T29-G192) (Accession)

Molecular Weight

Approximately 60-75 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Ficolin-1 Antibody (1) [Janelia Fluor 646]
NBP1-05050JF646 0.1 mL

Mouse Monoclonal Ficolin-1 Antibody (1) [Janelia Fluor 646]

Sign In for Pricing
View Details
STFR P006-210x297-AL-CRD/1 AC Signs
822620 Card of 1 Pictogram(s)

STFR P006-210x297-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
Human Neuromedin B (NMB) CLIA Kit
abx490237-01 96 Tests

Human Neuromedin B (NMB) CLIA Kit

Sign In for Pricing
View Details
Human Neuromedin B (NMB) CLIA Kit
abx490237-02 5x 96 Tests

Human Neuromedin B (NMB) CLIA Kit

Sign In for Pricing
View Details
Human Neuromedin B (NMB) CLIA Kit
abx490237-03 10x 96 Tests

Human Neuromedin B (NMB) CLIA Kit

Sign In for Pricing
View Details
JBS Paratungstate Cluster Kit
JBS-PK-107 21 mg

JBS Paratungstate Cluster Kit

Sign In for Pricing
View Details