Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RC, Human (HEK293, Fc)

IL-17RC (Interleukin 17 receptor C), a receptor for IL-17A and IL-17F, is a type I membrane glycoprotein. It is expressed on a variety of nonhematopoietic cell types, and plays a role in inflammatory diseases, including autoimmunity and certain cancers. IL-17RC associates with IL-17RA to form a signaling receptor complex for IL-17A and IL-17F[1][2].IL-17RC Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag.

Product Specifications

Product Name Alternative

IL-17RC Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rc-protein-human-434a-a-hek293-fc.html

Purity

93.70

Smiles

LERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWA

Molecular Formula

84818 (Gene_ID) Q8NAC3-3 (L21-A454) (Accession)

Molecular Weight

90-120 kDa

References & Citations

[1]Allen W Ho, et al. IL-17RC: a partner in IL-17 signaling and beyond. Semin Immunopathol. 2010 Mar;32 (1) :33-42.|[2]Dongxia Ge, et al. Expression of interleukin-17RC protein in normal human tissues. Int Arch Med. 2008 Oct 17;1 (1) :19.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCB 81 [CAS:70362-50-4] 500ug/ml in Iso-octane
PCB081K5ZT1 1 mL

PCB 81 [CAS:70362-50-4] 500ug/ml in Iso-octane

Sign In for Pricing
View Details
Human RAET1E Protein Lysate
MBS8418259-01 0.02 mg

Human RAET1E Protein Lysate

Sign In for Pricing
View Details
Human RAET1E Protein Lysate
MBS8418259-02 5x 0.02 mg

Human RAET1E Protein Lysate

Sign In for Pricing
View Details
Oct-1/2 Monoclonal Antibody
E-AB-22047-01 20 µL

Oct-1/2 Monoclonal Antibody

Sign In for Pricing
View Details
Oct-1/2 Monoclonal Antibody
E-AB-22047-02 60 µL

Oct-1/2 Monoclonal Antibody

Sign In for Pricing
View Details
Oct-1/2 Monoclonal Antibody
E-AB-22047-03 120 µL

Oct-1/2 Monoclonal Antibody

Sign In for Pricing
View Details