Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-3/CD33, Mouse (HEK293, His)

Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Siglec-3/CD33 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-3-cd33-protein-mouse-g236r-hek-293-his.html

Purity

98.0

Smiles

DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSRQMRE

Molecular Formula

12489 (Gene_ID) Q63994-1 (D18-E240) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF640R conjugate, 0.1mg/mL
BNC402043-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details