Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-3/CD33, Mouse (HEK293, His)

Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Siglec-3/CD33 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-3-cd33-protein-mouse-g236r-hek-293-his.html

Purity

98.0

Smiles

DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSRQMRE

Molecular Formula

12489 (Gene_ID) Q63994-1 (D18-E240) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sh3bgr (NM_015825) AAV Particle
MR218317A1V 250 µL

Mouse Sh3bgr (NM_015825) AAV Particle

Sign In for Pricing
View Details
Anti-AKAP4 Rabbit pAb
GB113559-100 100 μL

Anti-AKAP4 Rabbit pAb

Sign In for Pricing
View Details
Hsa-miR-3922-5p inhibitor
HY-RI00882-01 5 nmol

Hsa-miR-3922-5p inhibitor

Sign In for Pricing
View Details
Hsa-miR-3922-5p inhibitor
HY-RI00882-02 20 nmol

Hsa-miR-3922-5p inhibitor

Sign In for Pricing
View Details
Research Grade Belrestotug
DHH72407 100 μg

Research Grade Belrestotug

Sign In for Pricing
View Details
Olr1576 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV632162 1.0 µg DNA

Olr1576 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details