Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS55 AAV siRNA Pooled Vector
37870161 1.0 µg

PRSS55 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Cand1 Rat Pre-designed siRNA Set A
HY-RS28022 1 Set

Cand1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
GJC2 Antibody
R32259 100 µg

GJC2 Antibody

Sign In for Pricing
View Details
MYOG (Myogenin (Myogenic Factor 4), MYF4, MYOGENIN, bHLHc3) (MaxLight 750) discontinued
249096-ML750 100 µL

MYOG (Myogenin (Myogenic Factor 4), MYF4, MYOGENIN, bHLHc3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Choline-binding protein (opuBC)
MBS1304943-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Choline-binding protein (opuBC)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Choline-binding protein (opuBC)
MBS1304943-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis Choline-binding protein (opuBC)

Sign In for Pricing
View Details