Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLLT4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV698809 1.0 µg DNA

MLLT4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal HIV-1 gp120 Antibody [mFluor Violet 500 SE]
NBP2-81822MFV500 0.1 mL

Rabbit Polyclonal HIV-1 gp120 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (MaxLight 750) discontinued
031327-ML750 100 µL

VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (001) [HRP]
NBP2-90709H 0.1 mL

Rabbit Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (001) [HRP]

Sign In for Pricing
View Details
Cinitapride Hydrogen Tartrate
C17672 25 mg

Cinitapride Hydrogen Tartrate

Sign In for Pricing
View Details
pEnCMV-GRK1-3XFLAG Plasmid
PVT28142 2 µg

pEnCMV-GRK1-3XFLAG Plasmid

Sign In for Pricing
View Details