Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a) BioAssayTM ELISA Kit (Human)
589676 96 Tests

Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Anti-Human GCGR Antibody (SAA0132)
FHE51810 100 μg

Anti-Human GCGR Antibody (SAA0132)

Sign In for Pricing
View Details
Mouse Rpl12 Pre-designed siRNA Set A
SI112195A 1 Each

Mouse Rpl12 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Prealbumin, ID (Transthyretin, TTR, TBPA, TTR, ATTR, PALB) (MaxLight 650) discontinued
P6000-11B-ML650 100 µL

Prealbumin, ID (Transthyretin, TTR, TBPA, TTR, ATTR, PALB) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Alpha 2-Antiplasmin, Alpha-2-AP ELISA KIT
E0664Mo-01 48 Well

Mouse Alpha 2-Antiplasmin, Alpha-2-AP ELISA KIT

Sign In for Pricing
View Details
Mouse Alpha 2-Antiplasmin, Alpha-2-AP ELISA KIT
E0664Mo-02 96 Well

Mouse Alpha 2-Antiplasmin, Alpha-2-AP ELISA KIT

Sign In for Pricing
View Details