Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tubd1 Pre-designed siRNA Set B
SI215411B 1 Each

Rat Tubd1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TPD52 Rabbit Polyclonal Antibody
E28PT4708 100 µL

TPD52 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human STOX1 shRNA (UAS) - Lentiviral human STOX1 shRNA (UAS, RFP) (25)
GTR15103559 1 Vial

Lentiviral human STOX1 shRNA (UAS) - Lentiviral human STOX1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rat Monoclonal IFN-gamma Antibody (37895) [HRP]
FAB485H 0.1 mL

Rat Monoclonal IFN-gamma Antibody (37895) [HRP]

Sign In for Pricing
View Details
Adra1d sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4447908 1.0 µg DNA

Adra1d sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SµLt3a2 Mouse shRNA Plasmid (Locus ID 215895)
TR518442 1 Kit

SµLt3a2 Mouse shRNA Plasmid (Locus ID 215895)

Sign In for Pricing
View Details