Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Probable Palmitoyltransferase ZDHHC24 (ZDHHC24) ELISA Kit
abx554201 96 Tests

Rat Probable Palmitoyltransferase ZDHHC24 (ZDHHC24) ELISA Kit

Sign In for Pricing
View Details
Anti-CSK antibody
STJ99130 200 µl

Anti-CSK antibody

Sign In for Pricing
View Details
POR sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1688707 1.0 µg DNA

POR sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Canine IL-17A ELISA Kit
ECI0369 96 Tests

Canine IL-17A ELISA Kit

Sign In for Pricing
View Details
RASD2 (GTP-binding Protein Rhes, MGC:4834, Ras Homolog Enriched in Striatum, Rhes, Tumor Endothelial Marker 2, TEM2) (MaxLight 405) discontinued
132338-ML405 100 µL

RASD2 (GTP-binding Protein Rhes, MGC:4834, Ras Homolog Enriched in Striatum, Rhes, Tumor Endothelial Marker 2, TEM2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae Dihydropyrimidinase 1 (dhp-1)
MBS1479094-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis briggsae Dihydropyrimidinase 1 (dhp-1)

Sign In for Pricing
View Details