Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Piperidolate hydrochloride
sc-476279 100 mg

Piperidolate hydrochloride

Sign In for Pricing
View Details
CNT2 Polyclonal Antibody
UB-GEN-674 100 µL

CNT2 Polyclonal Antibody

Sign In for Pricing
View Details
HAT1 Rabbit Polyclonal Antibody
TA347486 100 µg

HAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Wfdc17 (NM_001081957) Mouse Untagged Clone
MC215456 10 µg

Wfdc17 (NM_001081957) Mouse Untagged Clone

Sign In for Pricing
View Details
BC048671 Mouse shRNA Plasmid (Locus ID 243535)
TL516315 1 Kit

BC048671 Mouse shRNA Plasmid (Locus ID 243535)

Sign In for Pricing
View Details
Snrnp27 sgRNA CRISPR Lentivector set (Mouse)
K4610301 3x 1.0 µg

Snrnp27 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details