Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAT1 Antibody
MBS7051725-01 0.05 mg

ACAT1 Antibody

Sign In for Pricing
View Details
ACAT1 Antibody
MBS7051725-02 0.1 mg

ACAT1 Antibody

Sign In for Pricing
View Details
ACAT1 Antibody
MBS7051725-03 5x 0.1 mg

ACAT1 Antibody

Sign In for Pricing
View Details
AZDye546-Azide Abs/Em = 554/570 nm structural analog to Alexa Fluor® 546
CLK-1283-AZ-1 1 mg

AZDye546-Azide Abs/Em = 554/570 nm structural analog to Alexa Fluor® 546

Sign In for Pricing
View Details
DUSP9 Human shRNA Plasmid Kit (Locus ID 1852)
TF313343 1 Kit

DUSP9 Human shRNA Plasmid Kit (Locus ID 1852)

Sign In for Pricing
View Details
Rad51 (G-5) Alexa Fluor® 790
sc-133089 AF790 200 µg/mL

Rad51 (G-5) Alexa Fluor® 790

Sign In for Pricing
View Details