Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Transducer and Activator of Transcription 5B Phospho-Ser731 (STAT5B pS731) DNA-Binding ELISA Kit
abx596647 96 Tests

Signal Transducer and Activator of Transcription 5B Phospho-Ser731 (STAT5B pS731) DNA-Binding ELISA Kit

Sign In for Pricing
View Details
FGF-5 (F-11) AC
sc-376264 AC 500 µg/mL - 25% ag

FGF-5 (F-11) AC

Sign In for Pricing
View Details
Rabbit Polyclonal SHMT1 Antibody [Alexa Fluor 488]
NBP2-97303AF488 0.1 mL

Rabbit Polyclonal SHMT1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
(20S) -Protopanaxadiol-3-one
MF-0002575-01 5 mg

(20S) -Protopanaxadiol-3-one

Sign In for Pricing
View Details
(20S) -Protopanaxadiol-3-one
MF-0002575-02 50 mg

(20S) -Protopanaxadiol-3-one

Sign In for Pricing
View Details
TCF2 (Hepatocyte Nuclear Factor 1-beta, HNF-1-beta, HNF-1B, Homeoprotein LFB3, Transcription Factor 2, TCF-2, Variant Hepatic Nuclear Factor 1, vHNF1, HNF1B) (MaxLight 650)
134291-ML650 100 µL

TCF2 (Hepatocyte Nuclear Factor 1-beta, HNF-1-beta, HNF-1B, Homeoprotein LFB3, Transcription Factor 2, TCF-2, Variant Hepatic Nuclear Factor 1, vHNF1, HNF1B) (MaxLight 650)

Sign In for Pricing
View Details