Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fnbp1 3'UTR Luciferase Stable Cell Line
TU106647 1.0 mL

Fnbp1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human anti-nucleosome antibody IgG, AnuA-IgG ELISA Kit
SL0226Hu-01 48 Tests

Human anti-nucleosome antibody IgG, AnuA-IgG ELISA Kit

Sign In for Pricing
View Details
Human anti-nucleosome antibody IgG, AnuA-IgG ELISA Kit
SL0226Hu-02 96 Tests

Human anti-nucleosome antibody IgG, AnuA-IgG ELISA Kit

Sign In for Pricing
View Details
PRAP1 (NM_145202) Human Tagged Lenti ORF Clone
RC210031L4 10 µg

PRAP1 (NM_145202) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4'-Aminoacetanilide-2',3',5',6'-d4
TRC-A580011-25MG 25 mg

4'-Aminoacetanilide-2',3',5',6'-d4

Sign In for Pricing
View Details
KCNH7 antibody
70R-5110 50 ug

KCNH7 antibody

Sign In for Pricing
View Details