Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin (MYL4) (NM_002476) Human Tagged ORF Clone
RG213170 10 µg

Myosin (MYL4) (NM_002476) Human Tagged ORF Clone

Sign In for Pricing
View Details
MStrawberry Monoclonal Antibody (Mix)
RA11694-01 50 µL

MStrawberry Monoclonal Antibody (Mix)

Sign In for Pricing
View Details
MStrawberry Monoclonal Antibody (Mix)
RA11694-02 100 µL

MStrawberry Monoclonal Antibody (Mix)

Sign In for Pricing
View Details
ABCF1 3'UTR Luciferase Stable Cell Line
TU000084 1.0 mL

ABCF1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Ntn4 Rat shRNA Plasmid (Locus ID 299737)
TR705354 1 Kit

Ntn4 Rat shRNA Plasmid (Locus ID 299737)

Sign In for Pricing
View Details
Survivin Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-54474R-BF488 100 µL

Survivin Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details