Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ADAMTS5 Antibody (Monoclonal, 33A47)
M02802 100 µL

Anti-ADAMTS5 Antibody (Monoclonal, 33A47)

Sign In for Pricing
View Details
1-[2-Chloro-4-(4-chlorophenyl)butyl]-1H-imidazole (>85%)
TRC-C378065-250MG 250 mg

1-[2-Chloro-4-(4-chlorophenyl)butyl]-1H-imidazole (>85%)

Sign In for Pricing
View Details
Goat Melanoma metastasis surface adhesion molecule (MMSAM) ELISA Kit
NSL0397Gt 96 Tests

Goat Melanoma metastasis surface adhesion molecule (MMSAM) ELISA Kit

Sign In for Pricing
View Details
Collagen Alpha-6(IV) Chain (COL4A6) Antibody
abx149452 100 µg

Collagen Alpha-6(IV) Chain (COL4A6) Antibody

Sign In for Pricing
View Details
Anti-CCM2 Polyclonal Antibody
MF-0068950-01 50 µL

Anti-CCM2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CCM2 Polyclonal Antibody
MF-0068950-02 100 µL

Anti-CCM2 Polyclonal Antibody

Sign In for Pricing
View Details