Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP12 Protein, Human, Recombinant (catalytic domain)
E45H52032E0-20 µg 20 µg

MMP12 Protein, Human, Recombinant (catalytic domain)

Sign In for Pricing
View Details
Phospho-AQP2 (Ser264+261) Polyclonal Antibody, PerCP Conjugated
bs-4610R-PerCP 100 µL

Phospho-AQP2 (Ser264+261) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Gliomedin (GLDN) Rabbit Polyclonal Antibody
TA333404 100 µL

Gliomedin (GLDN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human TSGA13 shRNA (UAS) - Lentiviral human TSGA13 shRNA (UAS, RFP) (100)
GTR15340443 1 Vial

Lentiviral human TSGA13 shRNA (UAS) - Lentiviral human TSGA13 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
1,2-Dibromo-3-nitrobenzene
410642-01 100 mg

1,2-Dibromo-3-nitrobenzene

Sign In for Pricing
View Details
1,2-Dibromo-3-nitrobenzene
410642-02 250 mg

1,2-Dibromo-3-nitrobenzene

Sign In for Pricing
View Details