Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK12 Peptide
DF4306-BP 1 mg

KCNK12 Peptide

Sign In for Pricing
View Details
3,3’-Diiodo-L-thyronine
TRC-D455150-10MG 10 mg

3,3’-Diiodo-L-thyronine

Sign In for Pricing
View Details
ATP2A1 Rabbit Monoclonal Antibody [KD Validation]
E51K1758 40 µL

ATP2A1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
CPNE1 (Copine-1, Copine I, CPN1, MGC1142) (PE)
MBS6157243-01 0.1 mL

CPNE1 (Copine-1, Copine I, CPN1, MGC1142) (PE)

Sign In for Pricing
View Details
CPNE1 (Copine-1, Copine I, CPN1, MGC1142) (PE)
MBS6157243-02 5x 0.1 mL

CPNE1 (Copine-1, Copine I, CPN1, MGC1142) (PE)

Sign In for Pricing
View Details
Ad-mCherry-p62
C3016-10ml 10 mL

Ad-mCherry-p62

Sign In for Pricing
View Details