Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ABI2 siRNA
abx906409-01 15 nmol

Human ABI2 siRNA

Sign In for Pricing
View Details
Human ABI2 siRNA
abx906409-02 30 nmol

Human ABI2 siRNA

Sign In for Pricing
View Details
STK16 (C-term) Rabbit Polyclonal Antibody
AP13931PU-N 400 µL

STK16 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SH3KBP1 Protein Vector (Mouse) (pPM-C-HA)
43681025 500 ng

SH3KBP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human RGSL1 shRNA (UAS) - Lentiviral human RGSL1 shRNA (UAS, RFP) plasmid
GTR15317812 1 Vial

Lentiviral human RGSL1 shRNA (UAS) - Lentiviral human RGSL1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
XRCC6 Antibody Pair
MBS7041768-01 1 Pair (Sufficient for 5x 96 Well Plates)

XRCC6 Antibody Pair

Sign In for Pricing
View Details