Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calmodulin (CAM) Sheep ELISA Kit
C0870 96 Tests

Calmodulin (CAM) Sheep ELISA Kit

Sign In for Pricing
View Details
pETDuet-1-SopB-EGFP Plasmid
PVT20689 2 µg

pETDuet-1-SopB-EGFP Plasmid

Sign In for Pricing
View Details
MK-8745 50mg
A13396-50 50 mg

MK-8745 50mg

Sign In for Pricing
View Details
Lentiviral mouse Bcl2 shRNA (UAS) - Lentiviral mouse Bcl2 shRNA (UAS, iRFP) plasmid
GTR15295723 1 Vial

Lentiviral mouse Bcl2 shRNA (UAS) - Lentiviral mouse Bcl2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
HBS1L Rabbit Polyclonal Antibody (Center)
E28PB1801 100 µL

HBS1L Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
EIF2B4 antibody
70R-17041 50 ul

EIF2B4 antibody

Sign In for Pricing
View Details