Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL8 Human shRNA Lentiviral Particle (Locus ID 79828)
TL303278V 500 µL Each

METTL8 Human shRNA Lentiviral Particle (Locus ID 79828)

Sign In for Pricing
View Details
Mouse Monoclonal IL-12 p70/IL-12A Antibody (2Y37) [Alexa Fluor 488]
NBP2-22038AF488 0.1 mL

Mouse Monoclonal IL-12 p70/IL-12A Antibody (2Y37) [Alexa Fluor 488]

Sign In for Pricing
View Details
CDK2 Antibody
DF3130-01 100 µL

CDK2 Antibody

Sign In for Pricing
View Details
CDK2 Antibody
DF3130-02 200 µL

CDK2 Antibody

Sign In for Pricing
View Details
Pcp2 Mouse shRNA Lentiviral Particle (Locus ID 18545)
TL518806V 500 µL Each

Pcp2 Mouse shRNA Lentiviral Particle (Locus ID 18545)

Sign In for Pricing
View Details
5-Bromo-4-chloro-3-indolyl-?-D-mannopyranoside
MF-0059348-01 10 mg

5-Bromo-4-chloro-3-indolyl-?-D-mannopyranoside

Sign In for Pricing
View Details