Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dipentylamine, mixture of isomers
sc-227919 25 mL

Dipentylamine, mixture of isomers

Sign In for Pricing
View Details
ATL3 (NM_015459) Human Recombinant Protein
PH37553M5 20 µg

ATL3 (NM_015459) Human Recombinant Protein

Sign In for Pricing
View Details
Hygromycin B
GA7834-1g 1 g

Hygromycin B

Sign In for Pricing
View Details
Anti-CFTR Antibody (C-Terminus) IHC-plus
MBS249937-01 0.05 mg

Anti-CFTR Antibody (C-Terminus) IHC-plus

Sign In for Pricing
View Details
Anti-CFTR Antibody (C-Terminus) IHC-plus
MBS249937-02 5x 0.05 mg

Anti-CFTR Antibody (C-Terminus) IHC-plus

Sign In for Pricing
View Details
CCDC12 (NM_001277074) Human Tagged ORF Clone
RG233345 10 µg

CCDC12 (NM_001277074) Human Tagged ORF Clone

Sign In for Pricing
View Details