Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAS3 Lentiviral Activation Particles (m)
sc-431406-LAC 200 µL

BCAS3 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Kcnn4 3'UTR Luciferase Stable Cell Line
TU206612 1.0 mL

Kcnn4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 18 Antibody (B23.1) [Alexa Fluor 405]
NBP3-11545AF405 0.1 mL

Mouse Monoclonal Cytokeratin 18 Antibody (B23.1) [Alexa Fluor 405]

Sign In for Pricing
View Details
MIR192 Rat MicroRNA Expression Plasmid (MI0000935)
SC403192 10 µg

MIR192 Rat MicroRNA Expression Plasmid (MI0000935)

Sign In for Pricing
View Details
Prohibitin (PHB) (MaxLight 750) discontinued
145092-ML750 100 µL

Prohibitin (PHB) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ODF3B Antibody (N-term)
MBS9211617-01 0.08 mL

ODF3B Antibody (N-term)

Sign In for Pricing
View Details