Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGPU6-ARHGEF28 (human) -shRNA1-EnCMV-EGFP-Neo
BZ39619 1 Vial

PGPU6-ARHGEF28 (human) -shRNA1-EnCMV-EGFP-Neo

Sign In for Pricing
View Details
GPRASP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0900505 3x 1.0 µg

GPRASP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Tril Rat shRNA Lentiviral Particle (Locus ID 362364)
TL703276V 500 µL Each

Tril Rat shRNA Lentiviral Particle (Locus ID 362364)

Sign In for Pricing
View Details
Recombinant Sturnira lilium NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L), partial
MBS7074575 Inquire

Recombinant Sturnira lilium NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L), partial

Sign In for Pricing
View Details
FLJ41423 Protein Vector (Human) (pPB-C-His)
PV052265 500 ng

FLJ41423 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PPP3R1 Rabbit pAb
MBS8544139-01 0.1 mL

PPP3R1 Rabbit pAb

Sign In for Pricing
View Details