Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESAM Antibody
E38QA2675 100 µL

ESAM Antibody

Sign In for Pricing
View Details
Lentiviral mouse Mutyh shRNA (UAS) - Lentiviral mouse Mutyh shRNA (UAS, iRFP) plasmid
GTR15288340 1 Vial

Lentiviral mouse Mutyh shRNA (UAS) - Lentiviral mouse Mutyh shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Gna15 shRNA (UAS) - Lentiviral mouse Gna15 shRNA (UAS) plasmid
GTR15166615 1 Vial

Lentiviral mouse Gna15 shRNA (UAS) - Lentiviral mouse Gna15 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Il22ra2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3750906 1.0 µg DNA

Il22ra2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse KCNS1 siRNA
abx921317-01 15 nmol

Mouse KCNS1 siRNA

Sign In for Pricing
View Details
Mouse KCNS1 siRNA
abx921317-02 30 nmol

Mouse KCNS1 siRNA

Sign In for Pricing
View Details