Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ROBO2 Antibody
NBP3-25111 100 µL

Rabbit Polyclonal ROBO2 Antibody

Sign In for Pricing
View Details
Recombinant Yersinia pestis Spermidine export protein MdtI (mdtI), partial
MBS7064258 Inquire

Recombinant Yersinia pestis Spermidine export protein MdtI (mdtI), partial

Sign In for Pricing
View Details
EGFL5 HDR Plasmid (m)
sc-432935-HDR 20 µg

EGFL5 HDR Plasmid (m)

Sign In for Pricing
View Details
MAGI2 Antibody, Biotin conjugated
MBS7105312-01 0.05 mg

MAGI2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MAGI2 Antibody, Biotin conjugated
MBS7105312-02 0.1 mg

MAGI2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MAGI2 Antibody, Biotin conjugated
MBS7105312-03 5x 0.1 mg

MAGI2 Antibody, Biotin conjugated

Sign In for Pricing
View Details