Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

488 Anti-Mouse F4/80 Antibody (CI:A3-1)
MBS7620451-01 50 Tests

488 Anti-Mouse F4/80 Antibody (CI:A3-1)

Sign In for Pricing
View Details
488 Anti-Mouse F4/80 Antibody (CI:A3-1)
MBS7620451-02 100 Tests

488 Anti-Mouse F4/80 Antibody (CI:A3-1)

Sign In for Pricing
View Details
488 Anti-Mouse F4/80 Antibody (CI:A3-1)
MBS7620451-03 5x 100 Tests

488 Anti-Mouse F4/80 Antibody (CI:A3-1)

Sign In for Pricing
View Details
RON (MST1R) Human shRNA Lentiviral Particle (Locus ID 4486)
TL320425V 500 µL Each

RON (MST1R) Human shRNA Lentiviral Particle (Locus ID 4486)

Sign In for Pricing
View Details
PBLD Mouse Monoclonal Antibody [Clone ID: OTI7G5]
TA501994 100 µL

PBLD Mouse Monoclonal Antibody [Clone ID: OTI7G5]

Sign In for Pricing
View Details
TEAD2 Protein Vector (Mouse) (pPB-N-His)
PV237459 500 ng

TEAD2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details