Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-Fetoprotein Lens Culinaris Agglutinin 2 (αFP-L2) Guinea Pig ELISA Kit
B3356 96 Tests

Alpha-Fetoprotein Lens Culinaris Agglutinin 2 (αFP-L2) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Human SERPINA9 Pre-designed siRNA Set A
SI014563A 1 Each

Human SERPINA9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human RBFOX2 qPCR Primer Pair
QH36005S 200 Tests

Human RBFOX2 qPCR Primer Pair

Sign In for Pricing
View Details
TRPC7, CT (TRPC7, TRP7, Short transient receptor potential channel 7, Transient receptor protein 7) (Azide free) (HRP)
MBS6358851-01 0.2 mL

TRPC7, CT (TRPC7, TRP7, Short transient receptor potential channel 7, Transient receptor protein 7) (Azide free) (HRP)

Sign In for Pricing
View Details
TRPC7, CT (TRPC7, TRP7, Short transient receptor potential channel 7, Transient receptor protein 7) (Azide free) (HRP)
MBS6358851-02 5x 0.2 mL

TRPC7, CT (TRPC7, TRP7, Short transient receptor potential channel 7, Transient receptor protein 7) (Azide free) (HRP)

Sign In for Pricing
View Details
IKAP (IKK-Complex-Associated Protein) (Biotin)
301372-Biotin 100 µL

IKAP (IKK-Complex-Associated Protein) (Biotin)

Sign In for Pricing
View Details