Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7217793-01 48 Well

Human Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Human Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7217793-02 96 Well

Human Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Human Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7217793-03 5x 96 Well

Human Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Human Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7217793-04 10x 96 Well

Human Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Human Artemin ELISA Kit
CEK2108 96 Tests

Human Artemin ELISA Kit

Sign In for Pricing
View Details
SENP2 Protein Lysate (Human) with C-Ha Tag
43372031 100 µg

SENP2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details