Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (248a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-248a-a-hek-293-his.html

Purity

98.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

Approximately 38-55 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctnnal1 (NM_018761) Mouse Tagged Lenti ORF Clone
MR210340L4 10 µg

Ctnnal1 (NM_018761) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ptpn12 ORF Vector (Mouse) (pORF)
ORF055215 1.0 µg DNA

Ptpn12 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CCNJL Protein Vector (Rat) (pPB-N-His)
PV258323 500 ng

CCNJL Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Zfp963 Protein Vector (Mouse) (pPB-C-His)
PV250626 500 ng

Zfp963 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Oxygen-Evolving Enhancer Protein 1, Chloroplastic (PSBO) Antibody (HRP)
abx319837-01 20 µg

Oxygen-Evolving Enhancer Protein 1, Chloroplastic (PSBO) Antibody (HRP)

Sign In for Pricing
View Details
Oxygen-Evolving Enhancer Protein 1, Chloroplastic (PSBO) Antibody (HRP)
abx319837-02 50 µg

Oxygen-Evolving Enhancer Protein 1, Chloroplastic (PSBO) Antibody (HRP)

Sign In for Pricing
View Details