Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin K, Mouse (His)

Cathepsin K protein is a thiol protease that is critical in osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Its potential role in extracellular matrix degradation is noteworthy. Cathepsin K Protein, Mouse (His) is the recombinant mouse-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin K Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-k-protein-mouse-his.html

Purity

97.00

Smiles

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM

Molecular Formula

13038 (Gene_ID) P55097 (V115-M329) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADX-47273
C17005-10mg 10 mg

ADX-47273

Sign In for Pricing
View Details
CYP2S1 (NM_030622) Human Recombinant Protein
E45H38509M5 20 µg

CYP2S1 (NM_030622) Human Recombinant Protein

Sign In for Pricing
View Details
Eldelumab (CXCL10)
591815 100 µg

Eldelumab (CXCL10)

Sign In for Pricing
View Details
Sodium hexanitrocobaltate (III)
orb2900156 1 g

Sodium hexanitrocobaltate (III)

Sign In for Pricing
View Details
Lentiviral human PRKCI sgRNA gene knockout kit - Lentiviral human PRKCI sgRNA gene knockout kit (25)
GTR15398643 1 Vial

Lentiviral human PRKCI sgRNA gene knockout kit - Lentiviral human PRKCI sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MIB1 (mindbomb Homolog 1 (Drosophila), DIP-1, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZANK2, ZZZ6) (MaxLight 405)
MBS6196712-01 0.1 mL

MIB1 (mindbomb Homolog 1 (Drosophila), DIP-1, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZANK2, ZZZ6) (MaxLight 405)

Sign In for Pricing
View Details