Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin K, Mouse (His)

Cathepsin K protein is a thiol protease that is critical in osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Its potential role in extracellular matrix degradation is noteworthy. Cathepsin K Protein, Mouse (His) is the recombinant mouse-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin K Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-k-protein-mouse-his.html

Purity

97.00

Smiles

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM

Molecular Formula

13038 (Gene_ID) P55097 (V115-M329) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSL/LIPE Rabbit Polyclonal Antibody (PE-Cy7)
orb915728 100 µL

HSL/LIPE Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Mouse Carnitine Palmitoyltransferase 1A, Liver (CPT1A) ELISA Kit
EK13413 48 Tests

Mouse Carnitine Palmitoyltransferase 1A, Liver (CPT1A) ELISA Kit

Sign In for Pricing
View Details
TMPRSS2 (Transmembrane Protease (Serine 2) Rabbit ELISA Kit
H6463 96 Tests

TMPRSS2 (Transmembrane Protease (Serine 2) Rabbit ELISA Kit

Sign In for Pricing
View Details
Goat Basic fibroblast growth factor 6 ELISA Kit
MBS755373-01 48 Well

Goat Basic fibroblast growth factor 6 ELISA Kit

Sign In for Pricing
View Details
Goat Basic fibroblast growth factor 6 ELISA Kit
MBS755373-02 96 Well

Goat Basic fibroblast growth factor 6 ELISA Kit

Sign In for Pricing
View Details
Goat Basic fibroblast growth factor 6 ELISA Kit
MBS755373-03 5x 96 Well

Goat Basic fibroblast growth factor 6 ELISA Kit

Sign In for Pricing
View Details