Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin K, Mouse (His)

Cathepsin K protein is a thiol protease that is critical in osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Its potential role in extracellular matrix degradation is noteworthy. Cathepsin K Protein, Mouse (His) is the recombinant mouse-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin K Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-k-protein-mouse-his.html

Purity

97.00

Smiles

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM

Molecular Formula

13038 (Gene_ID) P55097 (V115-M329) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-PIN1 Antibody
DL93775A-01 50 µL

Rabbit anti-PIN1 Antibody

Sign In for Pricing
View Details
Rabbit anti-PIN1 Antibody
DL93775A-02 100 µL

Rabbit anti-PIN1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ANAPC13 Antibody [mFluor Violet 450 SE]
NBP2-97529MFV450 0.1 mL

Rabbit Polyclonal ANAPC13 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
IFluor® 532 Anti-human CD20 Antibody *HI20a*
10201071-AAT 500 Tests

IFluor® 532 Anti-human CD20 Antibody *HI20a*

Sign In for Pricing
View Details
KRT77 Protein Vector (Human) (pPB-C-His)
PV054017 500 ng

KRT77 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Ceramide from Bovine Spinal Cord
B2018110 10 mg

Ceramide from Bovine Spinal Cord

Sign In for Pricing
View Details