Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin K, Mouse (His)

Cathepsin K protein is a thiol protease that is critical in osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Its potential role in extracellular matrix degradation is noteworthy. Cathepsin K Protein, Mouse (His) is the recombinant mouse-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin K Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-k-protein-mouse-his.html

Purity

97.00

Smiles

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM

Molecular Formula

13038 (Gene_ID) P55097 (V115-M329) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHDC10 Antibody - C-terminal region (ARP55138_P050)
ARP55138_P050 100 µL

KLHDC10 Antibody - C-terminal region (ARP55138_P050)

Sign In for Pricing
View Details
PDK2 (PDK2, PDHK2, [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial, Pyruvate dehydrogenase kinase isoform 2) (FITC) discontinued
039842-FITC 200 µL

PDK2 (PDK2, PDHK2, [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial, Pyruvate dehydrogenase kinase isoform 2) (FITC) discontinued

Sign In for Pricing
View Details
Bcl-11b Lentiviral Activation Particles (h)
sc-403460-LAC 200 µL

Bcl-11b Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Glycerol Kinase 1 (GK) Antibody
abx009219-01 30 µL

Glycerol Kinase 1 (GK) Antibody

Sign In for Pricing
View Details
Glycerol Kinase 1 (GK) Antibody
abx009219-02 100 µL

Glycerol Kinase 1 (GK) Antibody

Sign In for Pricing
View Details
Glycerol Kinase 1 (GK) Antibody
abx009219-03 200 µL

Glycerol Kinase 1 (GK) Antibody

Sign In for Pricing
View Details