Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RYK, Human (HEK293, Fc)

RYK protein, together with FZD8, serves as a potential Wnt co-receptor for WNT1, WNT3, WNT3A and WNT5A, affecting neuronal differentiation, axon guidance and neurite growth. After WNT3 stimulation, RYK undergoes C-terminal cleavage and transfers intracellular products to the nucleus, which is critical for neuronal development. RYK Protein, Human (HEK293, Fc) is the recombinant human-derived RYK protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

RYK Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ryk-protein-human-hek293-fc.html

Purity

98.0

Smiles

PPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTSTR

Molecular Formula

6259 (Gene_ID) P34925/NP_002949.2 (P26-R227) (Accession)

Molecular Weight

Approximately 49.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-100 1x 100 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/493), CF568 conjugate, 0.1mg/mL
BNC680493-100 1x 100 µL

Moesin (MSN/493), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details