Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM14, Human (His-SUMO)

The RBM14 protein has different isoforms with multiple functions. Isoform 1 enhances transcription as a nuclear receptor coactivator, interacting with NCOA6 and CITED1. RBM14 Protein, Human (His-SUMO) is the recombinant human-derived RBM14 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBM14 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbm14-protein-human-his-sumo.html

Purity

90.0

Smiles

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM

Molecular Formula

10432 (Gene_ID) Q96PK6 (M1-M669) (Accession)

Molecular Weight

Approximately 85.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin 9 (29-159, His-tag) Human Protein
AR50081PU-N 500 µg

Cystatin 9 (29-159, His-tag) Human Protein

Sign In for Pricing
View Details
TWEAK Antibody / Tumor necrosis factor ligand superfamily member 12
RQ7668 100 µg

TWEAK Antibody / Tumor necrosis factor ligand superfamily member 12

Sign In for Pricing
View Details
Rabbit Polyclonal USP38 Antibody
NBP2-58097 100 µL

Rabbit Polyclonal USP38 Antibody

Sign In for Pricing
View Details
NPC2 ORF Vector (Human) (pORF)
ORF007173 1.0 µg DNA

NPC2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Rat Transmembrane protein 135 (Tmem135), partial
MBS7057429 Inquire

Recombinant Rat Transmembrane protein 135 (Tmem135), partial

Sign In for Pricing
View Details
PRKCB (Protein Kinase C beta, PKCB, PRKCB1, PRKCB2, PKC-beta) (FITC)
MBS6432956-01 0.1 mL

PRKCB (Protein Kinase C beta, PKCB, PRKCB1, PRKCB2, PKC-beta) (FITC)

Sign In for Pricing
View Details