Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Rat (P.pastoris)

The VEGF164 protein is a growth factor critical for vasculogenesis, vasculogenesis, and endothelial cell growth, inducing proliferation, promoting migration, inhibiting apoptosis, and enhancing vascular permeability. It binds to FLT1/VEGFR1, KDR/VEGFR2, heparan sulfate, heparin, NRP1 and DEAR/FBXW7-AS1 receptors. VEGF164 Protein, Rat (P.pastoris) is the recombinant rat-derived VEGF164 protein, expressed by P. pastoris , with tag free and A36T mutation.

Product Specifications

Product Name Alternative

VEGF164 Protein, Rat (P.pastoris), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf164-protein-rat-p-pastoris.html

Purity

98.0

Smiles

APTTEGEQKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

83785 (Gene_ID) P16612-2 (A27-R190, A36T) (Accession)

Molecular Weight

Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLNS1A Antibody (Center)
E45R05763G-1 100 µL

CLNS1A Antibody (Center)

Sign In for Pricing
View Details
Vom2r70 AAV Vector (Rat) (CMV)
50150106 1 µg

Vom2r70 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Oxaloacetate Decarboxylase, Pseudomonas sp.
orb3180876-01 10 mg

Oxaloacetate Decarboxylase, Pseudomonas sp.

Sign In for Pricing
View Details
Oxaloacetate Decarboxylase, Pseudomonas sp.
orb3180876-02 50 mg

Oxaloacetate Decarboxylase, Pseudomonas sp.

Sign In for Pricing
View Details
RPL37P10 CRISPRa sgRNA lentivector (set of three targets)(Human)
41618121 3x 1.0µg DNA

RPL37P10 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ACAT2 Protein Vector (Mouse) (pPB-C-His)
PV151598 500 ng

ACAT2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details