Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Mouse (HEK293, C-His)

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

M-CSF Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-mouse-hek293-c-his.html

Purity

97.00

Smiles

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Molecular Formula

12977 (Gene_ID) P07141-1 (K33-E262) (Accession)

Molecular Weight

Approximately 32-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP5 siRNA (h)
sc-75214 10 µM

GTPBP5 siRNA (h)

Sign In for Pricing
View Details
COL18A1 Protein Lysate (Rat) with C-HA Tag
16559036 100 µg

COL18A1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Complement, Feline, Mixed Sex discontinued discontinued
168111 10 mL

Complement, Feline, Mixed Sex discontinued discontinued

Sign In for Pricing
View Details
Human SHANK2 knockdown cell line
ABC-KD13741 1 Vial

Human SHANK2 knockdown cell line

Sign In for Pricing
View Details
hCG_1982709 antibody
70R-9054 50 ug

hCG_1982709 antibody

Sign In for Pricing
View Details
NSC-2888
T69142-01 25 mg

NSC-2888

Sign In for Pricing
View Details