Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Mouse (HEK293, C-His)

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

M-CSF Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-mouse-hek293-c-his.html

Purity

97.00

Smiles

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Molecular Formula

12977 (Gene_ID) P07141-1 (K33-E262) (Accession)

Molecular Weight

Approximately 32-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nanog protein
30R-AN042 0.02 mg

Nanog protein

Sign In for Pricing
View Details
FPGS Antibody, HRP conjugated
CSB-PA23719B0Rb-01 50 µg

FPGS Antibody, HRP conjugated

Sign In for Pricing
View Details
FPGS Antibody, HRP conjugated
CSB-PA23719B0Rb-02 100 µg

FPGS Antibody, HRP conjugated

Sign In for Pricing
View Details
hsa-miR-6884-3p miRNA Mimic
MCH03725 2x 2.5 nmol

hsa-miR-6884-3p miRNA Mimic

Sign In for Pricing
View Details
STOML2 Recombinant Antibody, PE Conjugated
bsm-62593R-PE-TR 20 µL

STOML2 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
March10 Recombinant Protein (Mouse)
RP149438 100 µg

March10 Recombinant Protein (Mouse)

Sign In for Pricing
View Details