Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Mouse (HEK293, C-His)

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

M-CSF Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-mouse-hek293-c-his.html

Purity

97.00

Smiles

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Molecular Formula

12977 (Gene_ID) P07141-1 (K33-E262) (Accession)

Molecular Weight

Approximately 32-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD96 Mouse Monoclonal Antibody (APC)
orb2972802-01 50 Tests

CD96 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
CD96 Mouse Monoclonal Antibody (APC)
orb2972802-02 100 Tests

CD96 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Anti-Phospho-CrkL (Tyr207) Antibody (3A223)
TMAY-01716-01 20 µL

Anti-Phospho-CrkL (Tyr207) Antibody (3A223)

Sign In for Pricing
View Details
Anti-Phospho-CrkL (Tyr207) Antibody (3A223)
TMAY-01716-02 100 µL

Anti-Phospho-CrkL (Tyr207) Antibody (3A223)

Sign In for Pricing
View Details
Guinea pig Alpha1 Antichymotrypsin (AACT) ELISA Kit
EIA07815Gu 1 Kit

Guinea pig Alpha1 Antichymotrypsin (AACT) ELISA Kit

Sign In for Pricing
View Details
DYNLL1 CRISPR Activation Plasmid (m)
sc-425176-ACT 20 µg

DYNLL1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details