Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter agglomerans Ice nucleation protein (iceE), partial

Product Specifications

Product Name Alternative

Ice nucleation protein

Abbreviation

Recombinant Enterobacter agglomerans iceE protein, partial

Gene Name

IceE

UniProt

P16239

Expression Region

1129-1258aa

Organism

Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans)

Target Sequence

MAGERGKLIAGADSTQTAGDRSKLLAGNNSYLTAGDRSKLTAGNDCILMAGDRSKLTAGINSILTAGCRSKLIGSNGSTLTAGENSVLIFRCWDGKRYTNVVAKTGKGGIEADMPYQMDEDNNIVNKPEE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Ice nucleation proteins enable bacteria to nucleate crystallization in supercooled water.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.7 kDa

References & Citations

"Isolation and characterization of hydroxylamine-induced mutations in the Erwinia herbicola ice nucleation gene that selectively reduce warm temperature ice nucleation activity." Gurian-Sherman D., Lindow S.E., Panopoulos N.J. Mol. Microbiol. 9:383-391 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-118057 1mg
A19962-1 1 mg

PD-118057 1mg

Sign In for Pricing
View Details
Neuropeptide W-23, Rat/Mouse (NPW-23)
302087 100 µg

Neuropeptide W-23, Rat/Mouse (NPW-23)

Sign In for Pricing
View Details
KLK7 Rabbit Polyclonal Antibody
orb583688 100 µL

KLK7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Testis Whole Tissue Lysate (Adult Whole Normal) - (Dry Ice)
NB820-59672 1 mg

Mouse Testis Whole Tissue Lysate (Adult Whole Normal) - (Dry Ice)

Sign In for Pricing
View Details
LOC500876 (NM_001145141) Rat Tagged ORF Clone Lentiviral Particle
RR209317L4V 200 µL

LOC500876 (NM_001145141) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SSBP1 Protein Lysate (Mouse) with C-HA Tag
45532034 100 µg

SSBP1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details