Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (G49-A118)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (G49-A118) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (G49-A118), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-g49-a118.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 8-12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNJ 303
C06992-5mg 5 mg

JNJ 303

Sign In for Pricing
View Details
Pdss2 Mouse Gene Knockout Kit (CRISPR)
KN513069 1 Kit

Pdss2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)
MBS2091551-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)
MBS2091551-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)
MBS2091551-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)
MBS2091551-04 1 mL

Biotin-Linked Polyclonal Antibody to Matrix Metalloproteinase 3 (MMP3)

Sign In for Pricing
View Details