Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin C/CST3, Human (HEK293, His)

Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cystatin C/CST3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-c-cst3-protein-human-hek-293-his.html

Purity

95.0

Smiles

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Molecular Formula

1471 (Gene_ID) P01034 (S27-A146) (Accession)

Molecular Weight

15-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF568 conjugate, 0.1mg/mL
BNC681815-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF640R conjugate, 0.1mg/mL
BNC401422-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details