Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin C/CST3, Human (HEK293, His)

Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cystatin C/CST3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-c-cst3-protein-human-hek-293-his.html

Purity

95.0

Smiles

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Molecular Formula

1471 (Gene_ID) P01034 (S27-A146) (Accession)

Molecular Weight

15-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deferiprone-d3 3-O-β-D-Glucuronide Sodium Salt
sc-498997 1 mg

Deferiprone-d3 3-O-β-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (PE)
MBS6183633-01 0.1 mL

FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (PE)

Sign In for Pricing
View Details
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (PE)
MBS6183633-02 5x 0.1 mL

FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (PE)

Sign In for Pricing
View Details
Myosin IF (MYO1F) Antibody
abx375606 100 µg

Myosin IF (MYO1F) Antibody

Sign In for Pricing
View Details
Cathepsin B (CTSB) (NM_147783) Human Tagged Lenti ORF Clone
RC210578L4 10 µg

Cathepsin B (CTSB) (NM_147783) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nori® Monkey 2-Plex ELISA Kits-PTX3/AGP
GR240177 96 Well

Nori® Monkey 2-Plex ELISA Kits-PTX3/AGP

Sign In for Pricing
View Details