Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Human (Biotinylated, HEK293, His-Avi)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8 (+) and CD4 (+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-human-hek-293-his-avi.html

Purity

95

Smiles

LQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Molecular Formula

3902 (Gene_ID) P18627-1 (L23-L450) (Accession)

Molecular Weight

Approximately 60-63 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5C1B (NT5C1B, AIRP, Cytosolic 5'-nucleotidase 1B, Autoimmune infertility-related protein, Cytosolic 5'-nucleotidase IB)
305296-01 50 µg

NT5C1B (NT5C1B, AIRP, Cytosolic 5'-nucleotidase 1B, Autoimmune infertility-related protein, Cytosolic 5'-nucleotidase IB)

Sign In for Pricing
View Details
NT5C1B (NT5C1B, AIRP, Cytosolic 5'-nucleotidase 1B, Autoimmune infertility-related protein, Cytosolic 5'-nucleotidase IB)
305296-02 100 µg

NT5C1B (NT5C1B, AIRP, Cytosolic 5'-nucleotidase 1B, Autoimmune infertility-related protein, Cytosolic 5'-nucleotidase IB)

Sign In for Pricing
View Details
TRNAD4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2480308 1.0 µg DNA

TRNAD4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
DUS3L sgRNA CRISPR Lentivector (Human) (Target 3)
K0637604 1.0 µg DNA

DUS3L sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GLUT12 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-2540R-BF750-01 20 µL

GLUT12 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
GLUT12 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-2540R-BF750-02 100 µL

GLUT12 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details