CD70, Mouse (HEK293, His)
CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in mouse contains TNF_2 domain and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Mouse (HEK293, Fc) is expressed in the HEK293 cells with N terminal 10*His-tag.
Product Specifications
Product Name Alternative
CD70 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd27l-protein-mouse-hek-293-his.html
Smiles
QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
Molecular Formula
21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog