Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD70, Mouse (HEK293, His)

CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in mouse contains TNF_2 domain and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Mouse (HEK293, Fc) is expressed in the HEK293 cells with N terminal 10*His-tag.

Product Specifications

Product Name Alternative

CD70 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd27l-protein-mouse-hek-293-his.html

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bowman MR, et al. The cloning of CD70 and its identification as the ligand for CD27. J Immunol. 1994 Feb 15;152 (4) :1756-61.|[2]Jacobs J, et al. CD70: An emerging target in cancer immunotherapy. Pharmacol Ther. 2015 Nov;155:1-10.|[3]Izawa K, et al. Inherited CD70 deficiency in humans reveals a critical role for the CD70-CD27 pathway in immunity to Epstein-Barr virus infection. J Exp Med. 2017 Jan;214 (1) :73-89.|[4]Brown GR, et al. CD27-CD27 ligand/CD70 interactions enhance alloantigen-induced proliferation and cytolytic activity in CD8+ T lymphocytes. J Immunol. 1995 Apr 15;154 (8) :3686-95.|[5]Kobata T, et al. CD27-CD70 interactions regulate B-cell activation by T cells. Proc Natl Acad Sci U S A. 1995 Nov 21;92 (24) :11249-53.|[6]Jin L, et al. CD70, a novel target of CAR T-cell therapy for gliomas. Neuro Oncol. 2018 Jan 10;20 (1) :55-65.|[7]Boursalian TE, et al. Targeting CD70 for human therapeutic use. Adv Exp Med Biol. 2009;647:108-19.|[8]Arens R, et al. Signaling through CD70 regulates B cell activation and IgG production. J Immunol. 2004 Sep 15;173 (6) :3901-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Relaxin 2 (RLN2) (NM_134441) Human Recombinant Protein
TP760820 50 µg

Relaxin 2 (RLN2) (NM_134441) Human Recombinant Protein

Sign In for Pricing
View Details
GALR2 Human Gene Knockout Kit (CRISPR)
KN422436 1 Kit

GALR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTF1A Human Gene Knockout Kit (CRISPR)
KN421496 1 Kit

PTF1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PTHrP (Parathyroid Hormone Related Protein) CLIA Kit
E-CL-H0953-01 24 Tests

Human PTHrP (Parathyroid Hormone Related Protein) CLIA Kit

Sign In for Pricing
View Details
Human PTHrP (Parathyroid Hormone Related Protein) CLIA Kit
E-CL-H0953-02 48 Tests

Human PTHrP (Parathyroid Hormone Related Protein) CLIA Kit

Sign In for Pricing
View Details
Human PTHrP (Parathyroid Hormone Related Protein) CLIA Kit
E-CL-H0953-03 96 Tests

Human PTHrP (Parathyroid Hormone Related Protein) CLIA Kit

Sign In for Pricing
View Details