Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Peptidoglycan-associated lipoprotein (pal)

Product Specifications

Product Name Alternative

PAL;15 kDa peptidoglycan-associated lipoprotein; PC protein; Outer membrane protein P6; OMP P6

Abbreviation

Recombinant Haemophilus influenzae Peptidoglycan-associated lipoprotein

Gene Name

Pal

UniProt

P10324

Expression Region

20-153aa

Organism

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Target Sequence

CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TNFRSF12A/FN14/TWEAKR Protein, Fc & His Tag
KMP1157 50 µg

Recombinant Human TNFRSF12A/FN14/TWEAKR Protein, Fc & His Tag

Sign In for Pricing
View Details
Olr567 (NM_001000326) Rat Tagged Lenti ORF Clone
RR214331L4 10 µg

Olr567 (NM_001000326) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal ARF1 Antibody (1B3) [DyLight 488]
NBP1-97935G 100 µL

Mouse Monoclonal ARF1 Antibody (1B3) [DyLight 488]

Sign In for Pricing
View Details
Rat Small Nuclear Ribonucleoprotein Polypeptide C ELISA Kit
MBS028695-01 48 Well

Rat Small Nuclear Ribonucleoprotein Polypeptide C ELISA Kit

Sign In for Pricing
View Details
Rat Small Nuclear Ribonucleoprotein Polypeptide C ELISA Kit
MBS028695-02 96 Well

Rat Small Nuclear Ribonucleoprotein Polypeptide C ELISA Kit

Sign In for Pricing
View Details
Rat Small Nuclear Ribonucleoprotein Polypeptide C ELISA Kit
MBS028695-03 5x 96 Well

Rat Small Nuclear Ribonucleoprotein Polypeptide C ELISA Kit

Sign In for Pricing
View Details