Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL3/Angiopoietin-like 3, Mouse (HEK293, His)

ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His) is a mouse recombinant ANGPTL3 with a 10-His tag at the C-terminus. Angiopoietin-like Protein 3, Mouse (HEK293, His) is produced by Mammalian expression system and the target gene encoding Ser17-Thr455 is expressed.

Product Specifications

Product Name Alternative

ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-like-protein-3-mouse-hek293-his.html

Purity

95.0

Smiles

SRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTHHHHHH

Molecular Formula

30924 (Gene_ID) Q9R182 (S17-T206) (Accession)

Molecular Weight

25-30 kDa

References & Citations

[1]Chen MC, et al. High-Serum Angiopoietin-Like Protein 3 Levels Associated with Cardiovascular Outcome in Patients with Coronary Artery Disease. Int J Hypertens. 2020 Mar 27;2020:2980954.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-100 1x 100 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF405S conjugate, 0.1mg/mL
BNC042041-500 1x 500 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details