Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK2, Human (HEK293, Fc)

SPINK2, a robust acrosin inhibitor, is vital for normal spermiogenesis, preventing premature activation of proacrosin and other proteases to avoid spermiogenesis defects. It likely regulates germ cell apoptosis mediated by serine proteases and displays inhibitory activity against trypsin, indicating involvement in diverse serine protease-dependent processes. SPINK2 Protein, Human (HEK293, Fc) is the recombinant human-derived SPINK2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

SPINK2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink2-protein-human-hek293-fc.html

Purity

90.00

Smiles

QFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC

Molecular Formula

6691 (Gene_ID) P20155/NP_066937.1 (Q24-C84) (Accession)

Molecular Weight

Approximately 33.6-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp6nl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4535308 1.0 µg DNA

Usp6nl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)
TRV-0064225-01 24 Tests

ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)

Sign In for Pricing
View Details
ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)
TRV-0064225-02 48 Tests

ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)

Sign In for Pricing
View Details
ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)
TRV-0064225-03 96 Tests

ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)

Sign In for Pricing
View Details
ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)
TRV-0064225-04 5x 96 Tests

ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)

Sign In for Pricing
View Details
ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)
TRV-0064225-05 10x 96 Tests

ELISA Kit for Myosin Binding Protein C, Slow Type (MYBPC1)

Sign In for Pricing
View Details