Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMELX, Human (His-SUMO)

AMELX Protein plays a central role in biomineralization, shaping crystallite formation during the secretory stage of tooth enamel development. Its pivotal function extends to structurally organizing and mineralizing developing enamel, emphasizing its significance in dental tissue architecture. Interactions with KRT5 suggest its involvement in molecular networks contributing to the orchestrated development and mineralization of tooth enamel. AMELX Protein, Human (His-SUMO) is the recombinant human-derived AMELX protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

AMELX Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amelx-protein-human-his-sumo.html

Purity

90.0

Smiles

MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Molecular Formula

265 (Gene_ID) Q99217 (M17-D191) (Accession)

Molecular Weight

Approximately 35.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF843 (Center) Rabbit Polyclonal Antibody
AP54729PU-N 400 µL

ZNF843 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Myocardin (MYOCD) activation kit by CRISPRa
GA114298 1 Kit

Human Myocardin (MYOCD) activation kit by CRISPRa

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF405S conjugate, 0.1mg/mL
BNC043416-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADSS1 (NM_152328) Human Recombinant Protein
TP308536L 1 mg

ADSS1 (NM_152328) Human Recombinant Protein

Sign In for Pricing
View Details
HDAC2 Rabbit Polyclonal Antibody
R1601-7 100 µL

HDAC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP35 Human Gene Knockout Kit (CRISPR)
KN419955 1 Kit

USP35 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details