Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMELX, Human (His-SUMO)

AMELX Protein plays a central role in biomineralization, shaping crystallite formation during the secretory stage of tooth enamel development. Its pivotal function extends to structurally organizing and mineralizing developing enamel, emphasizing its significance in dental tissue architecture. Interactions with KRT5 suggest its involvement in molecular networks contributing to the orchestrated development and mineralization of tooth enamel. AMELX Protein, Human (His-SUMO) is the recombinant human-derived AMELX protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

AMELX Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amelx-protein-human-his-sumo.html

Purity

90.0

Smiles

MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Molecular Formula

265 (Gene_ID) Q99217 (M17-D191) (Accession)

Molecular Weight

Approximately 35.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A3 (NM_213611) Human Over-expression Lysate
LC403888 20 µg

SLC25A3 (NM_213611) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS808705 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Human IgG (Fc heavy chain specific) Mouse Monoclonal Antibody [Clone ID: EM-07]
AM26025PU-N 100 µg

Human IgG (Fc heavy chain specific) Mouse Monoclonal Antibody [Clone ID: EM-07]

Sign In for Pricing
View Details
Nivolumab Biosimilar - Research Grade
ICH4009-10mg 10 mg (2x 5 mg)

Nivolumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CDAN1 (NM_138477) Human Recombinant Protein
TP309158 20 µg

CDAN1 (NM_138477) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Tbx4 activation kit by CRISPRa
GA204223 1 Kit

Mouse Tbx4 activation kit by CRISPRa

Sign In for Pricing
View Details