Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPM4, Human (HEK293, His)

The TPM4 protein binds actin filaments in muscle and non-muscle cells and critically regulates calcium-dependent muscle contraction with the help of the vertebrate troponin complex. In smooth muscle cells, TPM4 interacts with caldesmon and contributes to contraction regulation. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TPM4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tpm4-protein-human-hek293-his.html

Purity

97.00

Smiles

AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

Molecular Formula

7171 (Gene_ID) P67936 (A2-I248) (Accession)

Molecular Weight

35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TMEM107 Antibody
NBP2-81865 0.1 mg

Rabbit Polyclonal TMEM107 Antibody

Sign In for Pricing
View Details
Tas2r113 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3589608 1.0 µg DNA

Tas2r113 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Abagovomab
abx831040-01 100 µg

Abagovomab

Sign In for Pricing
View Details
Abagovomab
abx831040-02 1 mg

Abagovomab

Sign In for Pricing
View Details
ABCD3 Protein Vector (Human) (pPM-C-HA)
11065021 500 ng

ABCD3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SCN1A (NM_006920) Human Tagged ORF Clone
RG220167 10 µg

SCN1A (NM_006920) Human Tagged ORF Clone

Sign In for Pricing
View Details