Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRDD Polyclonal Antibody, PE Conjugated
bs-7615R-PE 100 µL

LRDD Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
CD48 Protein Vector (Human) (pPM-C-His)
PV008504 500 ng

CD48 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
RALY (NM_016732) Human Tagged ORF Clone
RC210723 10 µg

RALY (NM_016732) Human Tagged ORF Clone

Sign In for Pricing
View Details
LC3C Antibody (MAP1LC3C)
F46128-0.4ML 0.4 mL

LC3C Antibody (MAP1LC3C)

Sign In for Pricing
View Details
Sphingosine (d17:1)
MBS5820139 Inquire

Sphingosine (d17:1)

Sign In for Pricing
View Details
TP53BP2, NT (TP53BP2, ASPP2, BBP, Apoptosis-stimulating of p53 protein 2, Bcl2-binding protein, Renal carcinoma antigen NY-REN-51, Tumor suppressor p53-binding protein 2) (AP)
MBS6357494-01 0.2 mL

TP53BP2, NT (TP53BP2, ASPP2, BBP, Apoptosis-stimulating of p53 protein 2, Bcl2-binding protein, Renal carcinoma antigen NY-REN-51, Tumor suppressor p53-binding protein 2) (AP)

Sign In for Pricing
View Details