Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TM9SF2 Antibody [PerCP]
NBP2-98514PCP 0.1 mL

Rabbit Polyclonal TM9SF2 Antibody [PerCP]

Sign In for Pricing
View Details
GYRA Antibody
PHY3953S 150 μg

GYRA Antibody

Sign In for Pricing
View Details
Rabbit Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit
MBS9940011 Inquire

Rabbit Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to Ornithine Decarboxylase-1 (ODC-1) (Clone : ODC1/487)
36-1526-100 100 µg

Monoclonal Antibody to Ornithine Decarboxylase-1 (ODC-1) (Clone : ODC1/487)

Sign In for Pricing
View Details
Rabbit STLR-6 ELISA Kit
ERTS0301 96 Tests

Rabbit STLR-6 ELISA Kit

Sign In for Pricing
View Details
P38 MAPK (Phospho-Tyr182) Antibody
MBS8510236-01 0.1 mg

P38 MAPK (Phospho-Tyr182) Antibody

Sign In for Pricing
View Details