Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Glut1 Antibody (GLUT1/3132R) [PerCP]
NBP3-08502PCP 100 µL

Rabbit Monoclonal Glut1 Antibody (GLUT1/3132R) [PerCP]

Sign In for Pricing
View Details
CELF6 Antibody
A14229-100UL 100 µL

CELF6 Antibody

Sign In for Pricing
View Details
DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (AP)
MBS6130952-01 0.1 mL

DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (AP)

Sign In for Pricing
View Details
DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (AP)
MBS6130952-02 5x 0.1 mL

DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (AP)

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida pepB Protein (aa 1-434)
VAng-Cr7041-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida pepB Protein (aa 1-434)

Sign In for Pricing
View Details
Importin subunit α-6 (KPNA5) Rat ELISA Kit
E2444 96 Tests

Importin subunit α-6 (KPNA5) Rat ELISA Kit

Sign In for Pricing
View Details