Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Comt Mouse Pre-designed siRNA Set A
HY-RS03017 1 Set

Comt Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-ADD3 Polyclonal Antibody
HP522014-01 50 µg

Anti-ADD3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ADD3 Polyclonal Antibody
HP522014-02 100 µg

Anti-ADD3 Polyclonal Antibody

Sign In for Pricing
View Details
Proto-oncogene tyrosine-protein Kinase Src (SRC) Rat ELISA Kit
G4706 96 Tests

Proto-oncogene tyrosine-protein Kinase Src (SRC) Rat ELISA Kit

Sign In for Pricing
View Details
SMPD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV691945 1.0 µg DNA

SMPD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-Pleckstrin Antibody
CQA1329-01 30 µL

Anti-Pleckstrin Antibody

Sign In for Pricing
View Details