Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MAPK1IP1L shRNA Plasmid
abx981223-01 150 µg

Mouse MAPK1IP1L shRNA Plasmid

Sign In for Pricing
View Details
Mouse MAPK1IP1L shRNA Plasmid
abx981223-02 300 µg

Mouse MAPK1IP1L shRNA Plasmid

Sign In for Pricing
View Details
Taq DNA Polymerase (Buffer with Mgcl2)
BPC1038-2 1000 U

Taq DNA Polymerase (Buffer with Mgcl2)

Sign In for Pricing
View Details
Mouse ORM1-like protein 2, Ormdl2 ELISA KIT
ELI-22523m 96 Tests

Mouse ORM1-like protein 2, Ormdl2 ELISA KIT

Sign In for Pricing
View Details
TXND9 Rabbit Polyclonal Antibody
BT-AP13295-01 20 µL

TXND9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TXND9 Rabbit Polyclonal Antibody
BT-AP13295-02 50 µL

TXND9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details