Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFRP1 (m3) : 293T Lysate
sc-126435 100 µg - 200 µL

ARFRP1 (m3) : 293T Lysate

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD564839 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
EBI3 Rabbit Monoclonal Antibody
E56G3205 100 µL

EBI3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CISD2 Protein Vector (Rat) (pPM-C-HA)
PV260132 500 ng

CISD2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse 5730507C01Rik shRNA (UAS) - Lentiviral mouse 5730507C01Rik shRNA (UAS, GFP) plasmid
GTR15244486 1 Vial

Lentiviral mouse 5730507C01Rik shRNA (UAS) - Lentiviral mouse 5730507C01Rik shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CHKB Protein (N-His, Human)
P502537 100 µg

CHKB Protein (N-His, Human)

Sign In for Pricing
View Details