Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MCT2 Antibody
NBP3-30935-25ug 25 µg

Rabbit Polyclonal MCT2 Antibody

Sign In for Pricing
View Details
TRNAL26-set siRNA/shRNA/RNAi Lentivector (Human)
48164091 4x 500 ng

TRNAL26-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal ISG15/UCRP Antibody (239) [Allophycocyanin]
NBP2-90146APC 0.1 mL

Rabbit Monoclonal ISG15/UCRP Antibody (239) [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit
MBS451543-01 48 Tests

Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit
MBS451543-02 96 Tests

Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit
MBS451543-03 5x 96 Tests

Mouse Leukocyte Cell Derived Chemotaxin 2 (LECT2) ELISA Kit

Sign In for Pricing
View Details