Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human P27 (P27 Protein) ELISA Kit
FY-EH2291 96 Well

Human P27 (P27 Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse Lpin3 Pre-designed siRNA Set A
SI107780A 1 Each

Mouse Lpin3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Angelicin
SM1152-10mM 10 mM x 0.2 mL

Angelicin

Sign In for Pricing
View Details
DL-Methionine sulfoxide
M-130-25-50g 50 g

DL-Methionine sulfoxide

Sign In for Pricing
View Details
EEF1B2 (NM_021121) Human Recombinant Protein
TP300733L 1 mg

EEF1B2 (NM_021121) Human Recombinant Protein

Sign In for Pricing
View Details
MYL10 Protein Vector (Mouse) (pPM-C-His)
PV203477 500 ng

MYL10 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details