Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Aconitate hydratase B Antibody [DyLight 488]
NBP3-06108G 0.1 mL

Rabbit Polyclonal Aconitate hydratase B Antibody [DyLight 488]

Sign In for Pricing
View Details
Trim34a AAV siRNA Pooled Vector
47773164 1.0 µg

Trim34a AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SCGB3A1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
43160126 3x 1.0µg DNA

SCGB3A1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Lentiviral mouse Mag shRNA (UAS) - Lentiviral mouse Mag shRNA (UAS, iRFP) plasmid
GTR15227260 1 Vial

Lentiviral mouse Mag shRNA (UAS) - Lentiviral mouse Mag shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PTK6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38111111 3x 1.0 µg

PTK6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Gpr182 Mouse Gene Knockout Kit (CRISPR)
KN507228 1 Kit

Gpr182 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details