Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCNKB Protein Vector (Human) (pPB-C-His)
PV009629 500 ng

CLCNKB Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (MaxLight 405) discontinued
040482-ML405 100 µL

PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DSG3 Antibody, Biotin conjugated
A19905-100UG 100 µg

DSG3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SCYL1BP1 (GORAB) Mouse Monoclonal Antibody [Clone ID: LBI2D1]
AMM14500VCF 100 µg

SCYL1BP1 (GORAB) Mouse Monoclonal Antibody [Clone ID: LBI2D1]

Sign In for Pricing
View Details
Goat Polyclonal LASP1 Antibody
NB100-77338 0.1 mg

Goat Polyclonal LASP1 Antibody

Sign In for Pricing
View Details
CD63 Antibody / LAMP-3
V8252-100UG 100 µg

CD63 Antibody / LAMP-3

Sign In for Pricing
View Details