Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-CC, Mouse (HEK293, Fc)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Formula

54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANO3 shRNA (m) Lentiviral Particles
sc-154401-V 200 µL

ANO3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Spsb4 3'UTR Lenti-reporter-Luc Vector
45411086 1.0 µg

Spsb4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Phorbol 12-myristate 13-acetate
GK8317-5mg 5 mg

Phorbol 12-myristate 13-acetate

Sign In for Pricing
View Details
Human Selectin, Leukocyte (SELL) ELISA Kit
RD-SELL-Hu-01 96 Tests

Human Selectin, Leukocyte (SELL) ELISA Kit

Sign In for Pricing
View Details
Human Selectin, Leukocyte (SELL) ELISA Kit
RD-SELL-Hu-02 48 Tests

Human Selectin, Leukocyte (SELL) ELISA Kit

Sign In for Pricing
View Details
CornuLin (CRNN) (NM_016190) Human Mass Spec Standard
PH304641 10 µg

CornuLin (CRNN) (NM_016190) Human Mass Spec Standard

Sign In for Pricing
View Details