PDGF-CC, Mouse (HEK293, Fc)
The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
PDGF-CC Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-cc-protein-mouse-hek293-fc.html
Purity
95.0
Smiles
VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
Molecular Formula
54635 (Gene_ID) Q8CI19 (V235-G345) (Accession)
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
ATPAF2 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 2, ATP12 Homolog, ATP12, LP3663, MGC29736) (MaxLight 490)
DGKZ, CT (DGKZ, DAGK6, Diacylglycerol kinase zeta, Diglyceride kinase zeta) (MaxLight 550) discontinued
BCAR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
