Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chemerin/RARRES2, Mouse (HEK293, His)

Chemerin/RARRES2 proteins bind to signaling receptors and are involved in various processes, including promotion of adipocyte differentiation, protein phosphorylation, and insulin receptor signaling. It plays a role in brown adipocyte differentiation and is located in the extracellular region. Chemerin/RARRES2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Chemerin/RARRES2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chemerin-rarres2-protein-mouse-hek293-his.html

Purity

94.90

Smiles

MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS

Molecular Formula

71660 (Gene_ID) Q9DD06/NP_082128.1 (T17-S156) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin K Polyclonal Antibody, HRP Conjugated
bs-1611R-HRP 100 µL

Cathepsin K Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
SKF525A ∙ HCl
bs-82779C-01 100 mg

SKF525A ∙ HCl

Sign In for Pricing
View Details
SKF525A ∙ HCl
bs-82779C-02 500 mg

SKF525A ∙ HCl

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C4G9.22 (SPAC4G9.22)
MBS1157736-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4G9.22 (SPAC4G9.22)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C4G9.22 (SPAC4G9.22)
MBS1157736-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4G9.22 (SPAC4G9.22)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C4G9.22 (SPAC4G9.22)
MBS1157736-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4G9.22 (SPAC4G9.22)

Sign In for Pricing
View Details