Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Mouse (HEK293, His)

Adiponectin/Acrp30 Protein, Mouse (HEK293, His) is the most abundant peptide secreted by adipocytes, whose reduction plays a central role in obesity-related diseases, including insulin resistance/type 2 diabetes and cardiovascular disease[1].

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Molecular Formula

11450 (Gene_ID) Q60994 (E18-N247) (Accession)

Molecular Weight

Approximately 27-34 kDa due to the glycosylation

References & Citations

[1]Arunkumar E Achari, et al. Adiponectin, a Therapeutic Target for Obesity, Diabetes, and Endothelial Dysfunction. Int J Mol Sci. 2017 Jun 21;18 (6) :1321.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC9A3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV690202 1.0 µg DNA

SLC9A3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Interleukin-6 (IL-6)
MEC1008 96 Well

Interleukin-6 (IL-6)

Sign In for Pricing
View Details
ANKLE2 CRISPR Activation Plasmid (h2)
sc-411675-ACT-2 20 µg

ANKLE2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
ZNF165 (NM_003447) Human Tagged Lenti ORF Clone
RC205600L3 10 µg

ZNF165 (NM_003447) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human GLUT9 Protein - (Dry Ice)
H00056606-Q01-25ug 25 µg

Recombinant Human GLUT9 Protein - (Dry Ice)

Sign In for Pricing
View Details
RHOXF1 Antibody
orb1266738 400 μl

RHOXF1 Antibody

Sign In for Pricing
View Details