Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Mouse (HEK293, His)

The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

Molecular Formula

14184 (Gene_ID) Q7TSI8/NP_032036.2 (E21-Y367) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Centromere Protein F (CENPF) Antibody
abx430975 200 µL

Centromere Protein F (CENPF) Antibody

Sign In for Pricing
View Details
CD3D Rabbit Monoclonal Antibody
AMRe86208-01 1 Each

CD3D Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD3D Rabbit Monoclonal Antibody
AMRe86208-02 50 µL

CD3D Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD3D Rabbit Monoclonal Antibody
AMRe86208-03 100 µL

CD3D Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TAS2R41 Protein Lysate (Human) with C-Ha Tag
46195031 100 µg

TAS2R41 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MEL-1B-R (m) -PR
sc-149365-PR 10 µM - 20 µL

MEL-1B-R (m) -PR

Sign In for Pricing
View Details