Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A13, Human

The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A13 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a13-protein-human.html

Purity

95.0

Smiles

AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

Molecular Formula

6284 (Gene_ID) Q99584 (A2-K98) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal 5-HT1F Antibody
NLS3343 0.05 mL

Rabbit Polyclonal 5-HT1F Antibody

Sign In for Pricing
View Details
CD20 Antibody
V2397IHC-7ML 7 mL

CD20 Antibody

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2H2 (OR2H2) ELISA kit
GTR10471338 96 Well

Rabbit Olfactory receptor 2H2 (OR2H2) ELISA kit

Sign In for Pricing
View Details
Slc17a8 3'UTR GFP Stable Cell Line
TU168935 1.0 mL

Slc17a8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AdSS2 CRISPR/Cas9 KO Plasmid (m)
sc-419031 20 µg

AdSS2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Cat Kallikrein 10 ELISA Kit
MBS054165 Inquire

Cat Kallikrein 10 ELISA Kit

Sign In for Pricing
View Details