Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A13, Human

The S100A13 protein is critical for unconventional protein export, binding calcium and copper ions without interference. It is essential for copper-dependent stress-induced export of IL1A and FGF1. S100A13 Protein, Human is the recombinant human-derived S100A13 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A13 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a13-protein-human.html

Purity

95.0

Smiles

AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

Molecular Formula

6284 (Gene_ID) Q99584 (A2-K98) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Olfactory receptor 8H1 (OR8H1) ELISA Kit
GTR10313512 96 Well

Chicken Olfactory receptor 8H1 (OR8H1) ELISA Kit

Sign In for Pricing
View Details
Ribosomal Protein S6 Kinase Beta 1 Phospho-Ser424 (RPS6KB1 pS424) Cell ELISA Kit
abx596053 192 Tests

Ribosomal Protein S6 Kinase Beta 1 Phospho-Ser424 (RPS6KB1 pS424) Cell ELISA Kit

Sign In for Pricing
View Details
NEK5 Antibody
MBS8583322-01 0.1 mL

NEK5 Antibody

Sign In for Pricing
View Details
NEK5 Antibody
MBS8583322-02 0.1 mL (AF635)

NEK5 Antibody

Sign In for Pricing
View Details
NEK5 Antibody
MBS8583322-03 0.1 mL (AF610)

NEK5 Antibody

Sign In for Pricing
View Details
NEK5 Antibody
MBS8583322-04 0.1 mL (AF405S)

NEK5 Antibody

Sign In for Pricing
View Details