Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-2 adrenergic receptor (ADRB2), partial

Product Specifications

Product Name Alternative

(Beta-2 adrenoreceptor) (Beta-2 adrenoceptor)

Abbreviation

Recombinant Human ADRB2 protein, partial

Gene Name

ADRB2

UniProt

P07550

Expression Region

330-413aa

Organism

Homo sapiens (Human)

Target Sequence

PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.8 kDa

References & Citations

"Amino-terminal polymorphisms of the human beta 2-adrenergic receptor impart distinct agonist-promoted regulatory properties." Green S.A., Turki J., Innis M., Ligget S.B. Biochemistry 33:9414-9419 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spast (NM_016962) Mouse Recombinant Protein
TP509420 20 µg

Spast (NM_016962) Mouse Recombinant Protein

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) (NM_000360) Human Over-expression Lysate
LY424777 100 µg

Tyrosine Hydroxylase (TH) (NM_000360) Human Over-expression Lysate

Sign In for Pricing
View Details
PSMA (FOLH1) (NM_004476) Human Recombinant Protein
TP318310L 1 mg

PSMA (FOLH1) (NM_004476) Human Recombinant Protein

Sign In for Pricing
View Details
MECP2 pSer80 Rabbit Polyclonal Antibody
AP13005PU-N 400 µL

MECP2 pSer80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SEMCAP3 (PDZRN3) (NM_001303141) Human Tagged ORF Clone
RG239564 10 µg

SEMCAP3 (PDZRN3) (NM_001303141) Human Tagged ORF Clone

Sign In for Pricing
View Details
BFSP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]
TA804391AM 100 µL

BFSP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]

Sign In for Pricing
View Details