Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-2 adrenergic receptor (ADRB2), partial

Product Specifications

Product Name Alternative

(Beta-2 adrenoreceptor) (Beta-2 adrenoceptor)

Abbreviation

Recombinant Human ADRB2 protein, partial

Gene Name

ADRB2

UniProt

P07550

Expression Region

330-413aa

Organism

Homo sapiens (Human)

Target Sequence

PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.8 kDa

References & Citations

"Amino-terminal polymorphisms of the human beta 2-adrenergic receptor impart distinct agonist-promoted regulatory properties." Green S.A., Turki J., Innis M., Ligget S.B. Biochemistry 33:9414-9419 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS803910 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
RLF Human Gene Knockout Kit (CRISPR)
KN423079 1 Kit

RLF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Equilin 3-Sulfate-d4 Sodium Salt (stabilized with TRIS, 50% w/w)
TRC-E592822-1MG 1 mg

Equilin 3-Sulfate-d4 Sodium Salt (stabilized with TRIS, 50% w/w)

Sign In for Pricing
View Details
XIAP Human Gene Knockout Kit (CRISPR)
KN207627 1 Kit

XIAP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Chloro-6-[4-(ethoxycarbonyl)piperidino]-nicotinic acid
TRC-C031810-10G 10 g

5-Chloro-6-[4-(ethoxycarbonyl)piperidino]-nicotinic acid

Sign In for Pricing
View Details
Recombinant Human RBP5 Protein
PKSH033000-01 10 µg

Recombinant Human RBP5 Protein

Sign In for Pricing
View Details