Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-2 adrenergic receptor (ADRB2), partial

Product Specifications

Product Name Alternative

(Beta-2 adrenoreceptor) (Beta-2 adrenoceptor)

Abbreviation

Recombinant Human ADRB2 protein, partial

Gene Name

ADRB2

UniProt

P07550

Expression Region

330-413aa

Organism

Homo sapiens (Human)

Target Sequence

PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.8 kDa

References & Citations

"Amino-terminal polymorphisms of the human beta 2-adrenergic receptor impart distinct agonist-promoted regulatory properties." Green S.A., Turki J., Innis M., Ligget S.B. Biochemistry 33:9414-9419 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS804006 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), CF488A conjugate, 0.1mg/mL
BNC881468-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1468), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MST4 Recombinant Rabbit Monoclonal Antibody [JE64-64]
HA721094 100 µL

MST4 Recombinant Rabbit Monoclonal Antibody [JE64-64]

Sign In for Pricing
View Details
CMV TaqMan PCR Kit
TM36350 100 Reactions

CMV TaqMan PCR Kit

Sign In for Pricing
View Details
PPIAL4C Human qPCR Primer Pair (NM_001135789)
HP230445 200 Reactions

PPIAL4C Human qPCR Primer Pair (NM_001135789)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 6/KLK6 Protein (His Tag)
PKSH033341-01 10 µg

Recombinant Human Kallikrein 6/KLK6 Protein (His Tag)

Sign In for Pricing
View Details