GLP1R, Human (HEK293, N-His, C-Myc)
The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.
Product Specifications
Product Name Alternative
GLP1R Protein, Human (HEK293, N-His, C-Myc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/glp1r-protein-human-hek293-n-his-c-myc.html
Purity
98.0
Smiles
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular Formula
2740 (Gene_ID) P43220 (R24-Y145) (Accession)
Molecular Weight
Approximately 25-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Insulin (2D11-H5), CF647 conjugate, 0.1mg/mL
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
